HRASLS purified MaxPab mouse polyclonal antibody (B01P)
  • HRASLS purified MaxPab mouse polyclonal antibody (B01P)

HRASLS purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00057110-B01P
HRASLS purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human HRASLS protein.
Información adicional
Size 50 ug
Gene Name HRASLS
Gene Alias A-C1|H-REV107|HRASLS1|HSD28
Gene Description HRAS-like suppressor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAFNDCFSLNYPGNPCPGDLIEVFRPGYQHWALYLGDGYVINIAPVDGIPASFTSAKSVFSSKALVKMQLLKDVVGNDTYRINNKYDETYPPLPVEEIIKRSEFVIGQEVAYNLLVNNCEHFVTLLRYGEGVSEQANRAISTVEFVTAAVGVFSFLGLFPKGQRAKYY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HRASLS (NP_065119.1, 1 a.a. ~ 168 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57110

Enviar uma mensagem


HRASLS purified MaxPab mouse polyclonal antibody (B01P)

HRASLS purified MaxPab mouse polyclonal antibody (B01P)