PLSCR3 monoclonal antibody (M09), clone 2C8
  • PLSCR3 monoclonal antibody (M09), clone 2C8

PLSCR3 monoclonal antibody (M09), clone 2C8

Ref: AB-H00057048-M09
PLSCR3 monoclonal antibody (M09), clone 2C8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PLSCR3.
Información adicional
Size 100 ug
Gene Name PLSCR3
Gene Alias -
Gene Description phospholipid scramblase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLSCR3 (AAH11735, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57048
Clone Number 2C8
Iso type IgG2b Kappa

Enviar uma mensagem


PLSCR3 monoclonal antibody (M09), clone 2C8

PLSCR3 monoclonal antibody (M09), clone 2C8