PLSCR3 monoclonal antibody (M08), clone 1B5
  • PLSCR3 monoclonal antibody (M08), clone 1B5

PLSCR3 monoclonal antibody (M08), clone 1B5

Ref: AB-H00057048-M08
PLSCR3 monoclonal antibody (M08), clone 1B5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PLSCR3.
Información adicional
Size 100 ug
Gene Name PLSCR3
Gene Alias -
Gene Description phospholipid scramblase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLSCR3 (AAH11735, 1 a.a. ~ 295 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57048
Clone Number 1B5
Iso type IgG2a Kappa

Enviar uma mensagem


PLSCR3 monoclonal antibody (M08), clone 1B5

PLSCR3 monoclonal antibody (M08), clone 1B5