PLSCR3 MaxPab rabbit polyclonal antibody (D01)
  • PLSCR3 MaxPab rabbit polyclonal antibody (D01)

PLSCR3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00057048-D01
PLSCR3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PLSCR3 protein.
Información adicional
Size 100 uL
Gene Name PLSCR3
Gene Alias -
Gene Description phospholipid scramblase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLPGVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVRLADPGDRELLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGPCWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLSCR3 (AAH11735.1, 1 a.a. ~ 295 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 57048

Enviar uma mensagem


PLSCR3 MaxPab rabbit polyclonal antibody (D01)

PLSCR3 MaxPab rabbit polyclonal antibody (D01)