TWSG1 polyclonal antibody (A01)
  • TWSG1 polyclonal antibody (A01)

TWSG1 polyclonal antibody (A01)

Ref: AB-H00057045-A01
TWSG1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TWSG1.
Información adicional
Size 50 uL
Gene Name TWSG1
Gene Alias TSG
Gene Description twisted gastrulation homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TWSG1 (NP_065699, 124 a.a. ~ 223 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57045

Enviar uma mensagem


TWSG1 polyclonal antibody (A01)

TWSG1 polyclonal antibody (A01)