CIAPIN1 polyclonal antibody (A01)
  • CIAPIN1 polyclonal antibody (A01)

CIAPIN1 polyclonal antibody (A01)

Ref: AB-H00057019-A01
CIAPIN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CIAPIN1.
Información adicional
Size 50 uL
Gene Name CIAPIN1
Gene Alias 2810413N20Rik|Anamorsin|DRE2|PRO0915
Gene Description cytokine induced apoptosis inhibitor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CIAPIN1 (NP_064709, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 57019

Enviar uma mensagem


CIAPIN1 polyclonal antibody (A01)

CIAPIN1 polyclonal antibody (A01)