TULP4 monoclonal antibody (M05), clone 7B7
  • TULP4 monoclonal antibody (M05), clone 7B7

TULP4 monoclonal antibody (M05), clone 7B7

Ref: AB-H00056995-M05
TULP4 monoclonal antibody (M05), clone 7B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TULP4.
Información adicional
Size 100 ug
Gene Name TULP4
Gene Alias KIAA1397|TUSP
Gene Description tubby like protein 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,ELISA
Immunogen Prot. Seq MYAAVEHGPVLCSDSNILCLSWKGRVPKSEKEKPVCRRRYYEEGWLATGNGRGVVGVTFTSSHCRRDRSTPQRINFNLRGHNSEVVLVRWNEPYQKLAT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TULP4 (NP_001007467.1, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56995
Clone Number 7B7
Iso type IgG2b Kappa

Enviar uma mensagem


TULP4 monoclonal antibody (M05), clone 7B7

TULP4 monoclonal antibody (M05), clone 7B7