CDC42SE2 polyclonal antibody (A01)
  • CDC42SE2 polyclonal antibody (A01)

CDC42SE2 polyclonal antibody (A01)

Ref: AB-H00056990-A01
CDC42SE2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CDC42SE2.
Información adicional
Size 50 uL
Gene Name CDC42SE2
Gene Alias FLJ21967|SPEC2
Gene Description CDC42 small effector 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CDC42SE2 (NP_064625, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56990

Enviar uma mensagem


CDC42SE2 polyclonal antibody (A01)

CDC42SE2 polyclonal antibody (A01)