RGMA monoclonal antibody (M01), clone 6D7
  • RGMA monoclonal antibody (M01), clone 6D7

RGMA monoclonal antibody (M01), clone 6D7

Ref: AB-H00056963-M01
RGMA monoclonal antibody (M01), clone 6D7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RGMA.
Información adicional
Size 100 ug
Gene Name RGMA
Gene Alias RGM
Gene Description RGM domain family, member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDLPGR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RGMA (NP_064596.1, 326 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56963
Clone Number 6D7
Iso type IgG3 Kappa

Enviar uma mensagem


RGMA monoclonal antibody (M01), clone 6D7

RGMA monoclonal antibody (M01), clone 6D7