LHX9 monoclonal antibody (M08), clone 1D8
  • LHX9 monoclonal antibody (M08), clone 1D8

LHX9 monoclonal antibody (M08), clone 1D8

Ref: AB-H00056956-M08
LHX9 monoclonal antibody (M08), clone 1D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LHX9.
Información adicional
Size 100 ug
Gene Name LHX9
Gene Alias -
Gene Description LIM homeobox 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq LAQKTGLTKRVLQVWFQNARAKFRRNLLRQENGGVDKADGTSLPAPPSADSGALTPPGTATTLTDLTNPTITVVTSVTSNMDSHESGSPSQTTLTNLF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LHX9 (NP_001014434.1, 291 a.a. ~ 388 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56956
Clone Number 1D8
Iso type IgG2b Kappa

Enviar uma mensagem


LHX9 monoclonal antibody (M08), clone 1D8

LHX9 monoclonal antibody (M08), clone 1D8