XAB2 polyclonal antibody (A01)
  • XAB2 polyclonal antibody (A01)

XAB2 polyclonal antibody (A01)

Ref: AB-H00056949-A01
XAB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant XAB2.
Información adicional
Size 50 uL
Gene Name XAB2
Gene Alias DKFZp762C1015|HCNP|HCRN|NTC90|SYF1
Gene Description XPA binding protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MVVMARLSRPERPDLVFEEEDLPYEEEIMRNQFSVKCWLRYIEFKQGAPKPRLNQLYERALKLLPCSYKLWYRYLKARRAQVKHRCVTDPAYEDVNNCHERAFVFMHKMPRLWLDYCQFLMDQGRVTHTRRTFDRALRALPITQHSRIWPLYLRFLRSHPLPETAVRGYRRFLKLSPESAEEYIEYLKSSDRLDEAAQRLATVVNDERFVSKAGKSNYQLWHELCDLISQNPDKVQSLNVDAIIRGGLTRFTDQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen XAB2 (AAH07208.1, 1 a.a. ~ 855 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56949

Enviar uma mensagem


XAB2 polyclonal antibody (A01)

XAB2 polyclonal antibody (A01)