MEIS3 monoclonal antibody (M07), clone 4E12
  • MEIS3 monoclonal antibody (M07), clone 4E12

MEIS3 monoclonal antibody (M07), clone 4E12

Ref: AB-H00056917-M07
MEIS3 monoclonal antibody (M07), clone 4E12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MEIS3.
Información adicional
Size 100 ug
Gene Name MEIS3
Gene Alias DKFZp547H236|MRG2
Gene Description Meis homeobox 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MEIS3 (NP_001009813.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56917
Clone Number 4E12
Iso type IgG1 Kappa

Enviar uma mensagem


MEIS3 monoclonal antibody (M07), clone 4E12

MEIS3 monoclonal antibody (M07), clone 4E12