C1GALT1 polyclonal antibody (A01)
  • C1GALT1 polyclonal antibody (A01)

C1GALT1 polyclonal antibody (A01)

Ref: AB-H00056913-A01
C1GALT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant C1GALT1.
Información adicional
Size 50 uL
Gene Name C1GALT1
Gene Alias C1GALT|T-synthase
Gene Description core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen C1GALT1 (NP_064541, 264 a.a. ~ 363 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56913

Enviar uma mensagem


C1GALT1 polyclonal antibody (A01)

C1GALT1 polyclonal antibody (A01)