SPIRE1 polyclonal antibody (A01)
  • SPIRE1 polyclonal antibody (A01)

SPIRE1 polyclonal antibody (A01)

Ref: AB-H00056907-A01
SPIRE1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SPIRE1.
Información adicional
Size 50 uL
Gene Name SPIRE1
Gene Alias MGC150621|MGC150622|Spir-1
Gene Description spire homolog 1 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SEKPSTAHHRPLRSIARFSSKSKSMDKSDEELQFPKELMEDWSTMEVCVDCKKFISEIISSSRRSLVLANKRARLKRKTQSFYMSSPGPSEYCPSERTISEI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SPIRE1 (NP_064533, 482 a.a. ~ 583 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56907

Enviar uma mensagem


SPIRE1 polyclonal antibody (A01)

SPIRE1 polyclonal antibody (A01)