THAP10 purified MaxPab mouse polyclonal antibody (B01P)
  • THAP10 purified MaxPab mouse polyclonal antibody (B01P)

THAP10 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00056906-B01P
THAP10 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human THAP10 protein.
Información adicional
Size 50 ug
Gene Name THAP10
Gene Alias -
Gene Description THAP domain containing 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAPACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVPAPAPKRGEEGDQAGRLDTRGELQAARHSEAAPGPVSCTRPRAGKQAAASQITCENELVQTQPHADNPSNTVTSVPTHCEEGPVHKSTQISLKRPRHRSVGIQAKVKAFGKRLCNATTQTEELWSRTSSLFDIYSSDSETDTDWDIKSEQSDLSYMAVQVKEE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen THAP10 (NP_064532.1, 1 a.a. ~ 257 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56906

Enviar uma mensagem


THAP10 purified MaxPab mouse polyclonal antibody (B01P)

THAP10 purified MaxPab mouse polyclonal antibody (B01P)