DPYSL5 monoclonal antibody (M02), clone 2G4
  • DPYSL5 monoclonal antibody (M02), clone 2G4

DPYSL5 monoclonal antibody (M02), clone 2G4

Ref: AB-H00056896-M02
DPYSL5 monoclonal antibody (M02), clone 2G4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DPYSL5.
Información adicional
Size 100 ug
Gene Name DPYSL5
Gene Alias CRAM|CRMP-5|CRMP5|FLJ45383|Ulip6
Gene Description dihydropyrimidinase-like 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SFPDTVYKKLVQREKTLKVRGVDRTPYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSGIW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DPYSL5 (NP_064519, 466 a.a. ~ 564 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56896
Clone Number 2G4
Iso type IgG2b Kappa

Enviar uma mensagem


DPYSL5 monoclonal antibody (M02), clone 2G4

DPYSL5 monoclonal antibody (M02), clone 2G4