AGPAT4 purified MaxPab mouse polyclonal antibody (B01P)
  • AGPAT4 purified MaxPab mouse polyclonal antibody (B01P)

AGPAT4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00056895-B01P
AGPAT4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AGPAT4 protein.
Información adicional
Size 50 ug
Gene Name AGPAT4
Gene Alias 1-AGPAT4|LPAAT-delta|dJ473J16.2
Gene Description 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQLVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKVLAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTLLGVLNGKKYHADLYV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AGPAT4 (NP_064518.1, 1 a.a. ~ 378 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56895

Enviar uma mensagem


AGPAT4 purified MaxPab mouse polyclonal antibody (B01P)

AGPAT4 purified MaxPab mouse polyclonal antibody (B01P)