Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
AGPAT3 polyclonal antibody (A01)
Abnova
AGPAT3 polyclonal antibody (A01)
Ref: AB-H00056894-A01
AGPAT3 polyclonal antibody (A01)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a partial recombinant AGPAT3.
Información adicional
Size
50 uL
Gene Name
AGPAT3
Gene Alias
LPAAT-GAMMA1|MGC4604
Gene Description
1-acylglycerol-3-phosphate O-acyltransferase 3
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Re,ELISA
Immunogen Prot. Seq
VVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKGFTTAVKCLRGTVAAVYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFP
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
AGPAT3 (NP_064517, 155 a.a. ~ 259 a.a) partial recombinant protein with GST tag.
Storage Buffer
50 % glycerol
Gene ID
56894
Enviar uma mensagem
AGPAT3 polyclonal antibody (A01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*