MDM1 MaxPab mouse polyclonal antibody (B01)
  • MDM1 MaxPab mouse polyclonal antibody (B01)

MDM1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00056890-B01
MDM1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human MDM1 protein.
Información adicional
Size 50 uL
Gene Name MDM1
Gene Alias FLJ95264
Gene Description Mdm1 nuclear protein homolog (mouse)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPVRFKGLSEYQRNFLWKKSYLSESCNSSVGRKYPWAGLRSDQLGITKEPSFISKRRVPYHDPQISKSLEWNGAISESNVVASPEPEAPETPKSQEAEQKDVIQERVHSLEASRVPKRTRSHSADSRAEGASDVENNEGVTNHTPVNENVELEHSTKVLSENVDNGLDRLLRKKAGLTVVPSYNALRNSEYQRQFVWKTSKETAPAFAANQVFHNKSQFVPPFKGNSVIHETEYKRNFKGLSPVKEPKLRNDLRE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MDM1 (NP_059136, 1 a.a. ~ 714 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 56890

Enviar uma mensagem


MDM1 MaxPab mouse polyclonal antibody (B01)

MDM1 MaxPab mouse polyclonal antibody (B01)