RAD18 monoclonal antibody (M01), clone 3H7
  • RAD18 monoclonal antibody (M01), clone 3H7

RAD18 monoclonal antibody (M01), clone 3H7

Ref: AB-H00056852-M01
RAD18 monoclonal antibody (M01), clone 3H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAD18.
Información adicional
Size 100 ug
Gene Name RAD18
Gene Alias RNF73
Gene Description RAD18 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq EKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAD18 (NP_064550, 332 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56852
Clone Number 3H7
Iso type IgG2b Kappa

Enviar uma mensagem


RAD18 monoclonal antibody (M01), clone 3H7

RAD18 monoclonal antibody (M01), clone 3H7