IFNK purified MaxPab mouse polyclonal antibody (B01P)
  • IFNK purified MaxPab mouse polyclonal antibody (B01P)

IFNK purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00056832-B01P
IFNK purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IFNK protein.
Información adicional
Size 50 ug
Gene Name IFNK
Gene Alias RP11-27J8.1
Gene Description interferon, kappa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSTKPDMIQKCLWLEILMGIFIAGTLSLDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDENENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IFNK (Q9P0W0, 1 a.a. ~ 207 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56832

Enviar uma mensagem


IFNK purified MaxPab mouse polyclonal antibody (B01P)

IFNK purified MaxPab mouse polyclonal antibody (B01P)