JPH1 monoclonal antibody (M04), clone 2E6
  • JPH1 monoclonal antibody (M04), clone 2E6

JPH1 monoclonal antibody (M04), clone 2E6

Ref: AB-H00056704-M04
JPH1 monoclonal antibody (M04), clone 2E6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant JPH1.
Información adicional
Size 100 ug
Gene Name JPH1
Gene Alias DKFZp762L0313|JP-1|JP1
Gene Description junctophilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VADEQVTAIVNKPLMSKAPTKEAGAVVPQSKYSGRHHIPNPSNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen JPH1 (NP_065698, 501 a.a. ~ 579 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56704
Clone Number 2E6
Iso type IgG2a Kappa

Enviar uma mensagem


JPH1 monoclonal antibody (M04), clone 2E6

JPH1 monoclonal antibody (M04), clone 2E6