C21orf59 purified MaxPab mouse polyclonal antibody (B01P)
  • C21orf59 purified MaxPab mouse polyclonal antibody (B01P)

C21orf59 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00056683-B01P
C21orf59 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human C21orf59 protein.
Información adicional
Size 50 ug
Gene Name C21orf59
Gene Alias C21orf48|FLJ20467|FLJ37137|FLJ40247
Gene Description chromosome 21 open reading frame 59
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQIEELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVKDALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen C21orf59 (NP_067077.1, 1 a.a. ~ 290 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56683

Enviar uma mensagem


C21orf59 purified MaxPab mouse polyclonal antibody (B01P)

C21orf59 purified MaxPab mouse polyclonal antibody (B01P)