POLE4 polyclonal antibody (A01)
  • POLE4 polyclonal antibody (A01)

POLE4 polyclonal antibody (A01)

Ref: AB-H00056655-A01
POLE4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POLE4.
Información adicional
Size 50 uL
Gene Name POLE4
Gene Alias p12
Gene Description polymerase (DNA-directed), epsilon 4 (p12 subunit)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLE4 (NP_063949, 31 a.a. ~ 117 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56655

Enviar uma mensagem


POLE4 polyclonal antibody (A01)

POLE4 polyclonal antibody (A01)