EIF5A2 MaxPab rabbit polyclonal antibody (D01)
  • EIF5A2 MaxPab rabbit polyclonal antibody (D01)

EIF5A2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00056648-D01
EIF5A2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human EIF5A2 protein.
Información adicional
Size 100 uL
Gene Name EIF5A2
Gene Alias EIF-5A2|eIF5AII
Gene Description eukaryotic translation initiation factor 5A2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen EIF5A2 (NP_065123.1, 1 a.a. ~ 153 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 56648

Enviar uma mensagem


EIF5A2 MaxPab rabbit polyclonal antibody (D01)

EIF5A2 MaxPab rabbit polyclonal antibody (D01)