BCCIP polyclonal antibody (A01)
  • BCCIP polyclonal antibody (A01)

BCCIP polyclonal antibody (A01)

Ref: AB-H00056647-A01
BCCIP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant BCCIP.
Información adicional
Size 50 uL
Gene Name BCCIP
Gene Alias TOK-1|TOK1
Gene Description BRCA2 and CDKN1A interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq NKPCGKCYFYLLISKTFVEAEKNNSKKKPSNKKKAALMFANAEEEFFYEKAILKFNYSVQEESDTCLGGKWSFDDVPMTPLRTVMLIPGDKMNEIMDKLKEYLSV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen BCCIP (AAH09771, 210 a.a. ~ 314 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56647

Enviar uma mensagem


BCCIP polyclonal antibody (A01)

BCCIP polyclonal antibody (A01)