INPP5E purified MaxPab rabbit polyclonal antibody (D01P)
  • INPP5E purified MaxPab rabbit polyclonal antibody (D01P)

INPP5E purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00056623-D01P
INPP5E purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human INPP5E protein.
Información adicional
Size 100 ug
Gene Name INPP5E
Gene Alias MGC117201|PPI5PIV
Gene Description inositol polyphosphate-5-phosphatase, 72 kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSKAENLRPSEPAPQPPEGRTLQGQLPGAPPAQRAGSPPDAPGSESPALACSTPATPSGEDPPARAAPIAPRPPARPRLERALSLDDKGWRRRRFRGSQEDLEARNGTSPSRGSVQSEGPGAPAHSCSPPCLSTSLQEIPKSRGVLSSERGSPSSGGNPLSGVASSSPNLPHRDAAVAGSSPRLPSLLPPRPPPALSLDIASDSLRTANKVDSDLADYKLRAQPLLVRAHSSLGPGRPRSPLACDDCSLRSAKS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen INPP5E (NP_063945.2, 1 a.a. ~ 644 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56623

Enviar uma mensagem


INPP5E purified MaxPab rabbit polyclonal antibody (D01P)

INPP5E purified MaxPab rabbit polyclonal antibody (D01P)