DIABLO purified MaxPab mouse polyclonal antibody (B01P)
  • DIABLO purified MaxPab mouse polyclonal antibody (B01P)

DIABLO purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00056616-B01P
DIABLO purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DIABLO protein.
Información adicional
Size 50 ug
Gene Name DIABLO
Gene Alias DIABLO-S|FLJ10537|FLJ25049|SMAC|SMAC3
Gene Description diablo homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DIABLO (NP_063940.1, 1 a.a. ~ 239 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56616

Enviar uma mensagem


DIABLO purified MaxPab mouse polyclonal antibody (B01P)

DIABLO purified MaxPab mouse polyclonal antibody (B01P)