EIF4ENIF1 monoclonal antibody (M01), clone 2C4
  • EIF4ENIF1 monoclonal antibody (M01), clone 2C4

EIF4ENIF1 monoclonal antibody (M01), clone 2C4

Ref: AB-H00056478-M01
EIF4ENIF1 monoclonal antibody (M01), clone 2C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EIF4ENIF1.
Información adicional
Size 100 ug
Gene Name EIF4ENIF1
Gene Alias 4E-T|Clast4|FLJ21601|FLJ26551
Gene Description eukaryotic translation initiation factor 4E nuclear import factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq NPRPGTPLHLAMVQQQLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFGSDVLQQPLPSMPAKVISVDELEYRQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EIF4ENIF1 (NP_062817, 886 a.a. ~ 985 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56478
Clone Number 2C4
Iso type IgG2a Kappa

Enviar uma mensagem


EIF4ENIF1 monoclonal antibody (M01), clone 2C4

EIF4ENIF1 monoclonal antibody (M01), clone 2C4