CCL28 monoclonal antibody (M03), clone 3A7
  • CCL28 monoclonal antibody (M03), clone 3A7

CCL28 monoclonal antibody (M03), clone 3A7

Ref: AB-H00056477-M03
CCL28 monoclonal antibody (M03), clone 3A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CCL28.
Información adicional
Size 100 ug
Gene Name CCL28
Gene Alias CCK1|MEC|MGC71902|SCYA28
Gene Description chemokine (C-C motif) ligand 28
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CCL28 (NP_062820, 24 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56477
Clone Number 3A7
Iso type IgG2a Kappa

Enviar uma mensagem


CCL28 monoclonal antibody (M03), clone 3A7

CCL28 monoclonal antibody (M03), clone 3A7