TRPV5 monoclonal antibody (M02), clone 2A6
  • TRPV5 monoclonal antibody (M02), clone 2A6

TRPV5 monoclonal antibody (M02), clone 2A6

Ref: AB-H00056302-M02
TRPV5 monoclonal antibody (M02), clone 2A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TRPV5.
Información adicional
Size 100 ug
Gene Name TRPV5
Gene Alias CAT2|ECAC1|OTRPC3
Gene Description transient receptor potential cation channel, subfamily V, member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MGGFLPKAEGPGSQLQKLLPSFLVREQDWDQHLDKLHMLQQKRILESPLLRASKENDLSVLRQLLLDCTCDVRQRGALGETALHIAALYDNLEAALVLME
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TRPV5 (NP_062815, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56302
Clone Number 2A6
Iso type IgG1 Kappa

Enviar uma mensagem


TRPV5 monoclonal antibody (M02), clone 2A6

TRPV5 monoclonal antibody (M02), clone 2A6