IL1F9 monoclonal antibody (M02), clone 2A8
  • IL1F9 monoclonal antibody (M02), clone 2A8

IL1F9 monoclonal antibody (M02), clone 2A8

Ref: AB-H00056300-M02
IL1F9 monoclonal antibody (M02), clone 2A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL1F9.
Información adicional
Size 100 ug
Gene Name IL1F9
Gene Alias IL-1F9|IL-1H1|IL-1RP2|IL1E|IL1H1|IL1RP2
Gene Description interleukin 1 family, member 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL1F9 (NP_062564, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56300
Clone Number 2A8
Iso type IgG1 Kappa

Enviar uma mensagem


IL1F9 monoclonal antibody (M02), clone 2A8

IL1F9 monoclonal antibody (M02), clone 2A8