PARD3 monoclonal antibody (M03), clone 4G5
  • PARD3 monoclonal antibody (M03), clone 4G5

PARD3 monoclonal antibody (M03), clone 4G5

Ref: AB-H00056288-M03
PARD3 monoclonal antibody (M03), clone 4G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PARD3.
Información adicional
Size 100 ug
Gene Name PARD3
Gene Alias ASIP|Baz|Bazooka|FLJ21015|PAR3|PAR3alpha|PARD3A|SE2-5L16|SE2-5LT1|SE2-5T2
Gene Description par-3 partitioning defective 3 homolog (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDYAEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSPVDSNRSTPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PARD3 (AAH11711, 181 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56288
Clone Number 4G5
Iso type IgG2a Kappa

Enviar uma mensagem


PARD3 monoclonal antibody (M03), clone 4G5

PARD3 monoclonal antibody (M03), clone 4G5