GKN1 monoclonal antibody (M01), clone 2E5
  • GKN1 monoclonal antibody (M01), clone 2E5

GKN1 monoclonal antibody (M01), clone 2E5

Ref: AB-H00056287-M01
GKN1 monoclonal antibody (M01), clone 2E5

Información del producto

Mouse monoclonal antibody raised against a full length recombinant GKN1.
Información adicional
Size 100 ug
Gene Name GKN1
Gene Alias AMP18|BRICD1|CA11|FOV|MGC70354|foveolin
Gene Description gastrokine 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GKN1 (AAH59778, 21 a.a. ~ 185 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56287
Clone Number 2E5
Iso type IgG1 kappa

Enviar uma mensagem


GKN1 monoclonal antibody (M01), clone 2E5

GKN1 monoclonal antibody (M01), clone 2E5