LRRC8A monoclonal antibody (M04), clone 8H9
  • LRRC8A monoclonal antibody (M04), clone 8H9

LRRC8A monoclonal antibody (M04), clone 8H9

Ref: AB-H00056262-M04
LRRC8A monoclonal antibody (M04), clone 8H9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LRRC8A.
Información adicional
Size 100 ug
Gene Name LRRC8A
Gene Alias FLJ10337|FLJ41617|KIAA1437|LRRC8
Gene Description leucine rich repeat containing 8 family, member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QNLAITANRIETLPPELFQCRKLRALHLGNNVLQSLPSRVGELTNLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWRADKEQA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LRRC8A (NP_062540.2, 711 a.a. ~ 810 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56262
Clone Number 8H9
Iso type IgG2a Kappa

Enviar uma mensagem


LRRC8A monoclonal antibody (M04), clone 8H9

LRRC8A monoclonal antibody (M04), clone 8H9