RNF17 monoclonal antibody (M01), clone 1E3
  • RNF17 monoclonal antibody (M01), clone 1E3

RNF17 monoclonal antibody (M01), clone 1E3

Ref: AB-H00056163-M01
RNF17 monoclonal antibody (M01), clone 1E3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RNF17.
Información adicional
Size 100 ug
Gene Name RNF17
Gene Alias FLJ11045|Mmip-2|SPATA23|TDRD4
Gene Description ring finger protein 17
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq IQCTRCGRRVSRSSGHHCELQCGHAFCELCLLMTEECTTIICPDCEVATAVNTRQRYYPMAGYIKEDSIMEKLQPKTIKNCSQDFKKTADQLTTGLERSASTDKTLLNSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF17 (NP_112567, 30 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56163
Clone Number 1E3
Iso type IgG2a Kappa

Enviar uma mensagem


RNF17 monoclonal antibody (M01), clone 1E3

RNF17 monoclonal antibody (M01), clone 1E3