PCDHA12 monoclonal antibody (M02), clone 1D3
  • PCDHA12 monoclonal antibody (M02), clone 1D3

PCDHA12 monoclonal antibody (M02), clone 1D3

Ref: AB-H00056137-M02
PCDHA12 monoclonal antibody (M02), clone 1D3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHA12.
Información adicional
Size 100 ug
Gene Name PCDHA12
Gene Alias MGC138485|MGC141932|PCDH-ALPHA12
Gene Description protocadherin alpha 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq LTGSVQIQITVLDVNDNGPAFDKPSYKVVLSENVQNDTRVIQLNASDPDEGLNGEISYGIKMILPVSEKCMFSINPDTGEIRIYGELDFEENNAYEIQVNAIDKGI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHA12 (NP_061726, 222 a.a. ~ 327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56137
Clone Number 1D3
Iso type IgG2b Kappa

Enviar uma mensagem


PCDHA12 monoclonal antibody (M02), clone 1D3

PCDHA12 monoclonal antibody (M02), clone 1D3