PCDHAC2 monoclonal antibody (M03), clone 3D12
  • PCDHAC2 monoclonal antibody (M03), clone 3D12

PCDHAC2 monoclonal antibody (M03), clone 3D12

Ref: AB-H00056134-M03
PCDHAC2 monoclonal antibody (M03), clone 3D12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHAC2.
Información adicional
Size 100 ug
Gene Name PCDHAC2
Gene Alias MGC71598|PCDH-ALPHA-C2
Gene Description protocadherin alpha subfamily C, 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq HLGAPSPRYLELDLTSGALFVNERIDREALCEQRPRCLLSLEVLAHNPVAVSAVEVEILDINDNSPRFPRPNYQLQVSESVAPGARFHIESAQDPDVGANSVQTYELSPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHAC2 (NP_061722, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56134
Clone Number 3D12
Iso type IgG2a Kappa

Enviar uma mensagem


PCDHAC2 monoclonal antibody (M03), clone 3D12

PCDHAC2 monoclonal antibody (M03), clone 3D12