PCDHGA1 monoclonal antibody (M01), clone 4C9
  • PCDHGA1 monoclonal antibody (M01), clone 4C9

PCDHGA1 monoclonal antibody (M01), clone 4C9

Ref: AB-H00056114-M01
PCDHGA1 monoclonal antibody (M01), clone 4C9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHGA1.
Información adicional
Size 100 ug
Gene Name PCDHGA1
Gene Alias MGC138287|MGC138289|PCDH-GAMMA-A1
Gene Description protocadherin gamma subfamily A, 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AFTQAQYHINVPENVPLGTQLLMVNATDPDEGANGEVTYSFHNVDHRVAQIFRLDSYTGEISNKEPLDFEEYKMYSMEVQAQDGAGLMAKVKVLIKVLDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGA1 (NP_061735, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56114
Clone Number 4C9
Iso type IgG2a Kappa

Enviar uma mensagem


PCDHGA1 monoclonal antibody (M01), clone 4C9

PCDHGA1 monoclonal antibody (M01), clone 4C9