PCDHGA9 monoclonal antibody (M01), clone 1G10
  • PCDHGA9 monoclonal antibody (M01), clone 1G10

PCDHGA9 monoclonal antibody (M01), clone 1G10

Ref: AB-H00056107-M01
PCDHGA9 monoclonal antibody (M01), clone 1G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHGA9.
Información adicional
Size 100 ug
Gene Name PCDHGA9
Gene Alias PCDH-GAMMA-A9
Gene Description protocadherin gamma subfamily A, 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VREDAPQGTVILLFNAHDRDSGKNGQVVCSIQENLSFTLENSEEDYYRLLTAQILDREKASEYNITVTATDRGTPPLSTEIHITLQVTDI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGA9 (NP_061744, 356 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56107
Clone Number 1G10
Iso type IgG1 Kappa

Enviar uma mensagem


PCDHGA9 monoclonal antibody (M01), clone 1G10

PCDHGA9 monoclonal antibody (M01), clone 1G10