PCDHGA10 monoclonal antibody (M04), clone 3A7
  • PCDHGA10 monoclonal antibody (M04), clone 3A7

PCDHGA10 monoclonal antibody (M04), clone 3A7

Ref: AB-H00056106-M04
PCDHGA10 monoclonal antibody (M04), clone 3A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PCDHGA10.
Información adicional
Size 100 ug
Gene Name PCDHGA10
Gene Alias PCDH-GAMMA-A10
Gene Description protocadherin gamma subfamily A, 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SDGGDPLRSGTVLVSVTVFDANDNAPVFTLPEYRVSVPENLPVGTQLLTVTATDRDEGANGEVTYSFRKLPDTQLLKFQLNKYTGEIKISENLDYEET
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PCDHGA10 (NP_061736.1, 219 a.a. ~ 316 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56106
Clone Number 3A7
Iso type IgG2a Kappa

Enviar uma mensagem


PCDHGA10 monoclonal antibody (M04), clone 3A7

PCDHGA10 monoclonal antibody (M04), clone 3A7