PCDHGB6 MaxPab mouse polyclonal antibody (B01)
  • PCDHGB6 MaxPab mouse polyclonal antibody (B01)

PCDHGB6 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00056100-B01
PCDHGB6 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human PCDHGB6 protein.
Información adicional
Size 50 uL
Gene Name PCDHGB6
Gene Alias PCDH-GAMMA-B6
Gene Description protocadherin gamma subfamily B, 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGGSCAQRRRAGPRQVLFPLLLPLFYPTLSEPIRYSIPEELAKGSVVGNLAKDLGLSVLDVSARKLRVSAEKLHFSVDAESGDLLVKNRIDREQICKERRRCELQLEAVVENPLNIFHVIVVIEDVNDHAPQFDKKEIHLEIFESASAGTRLSLDPATDPDININSIKDYKINSNPYFSLMVRVNSDGGKYPELSLEKLLDREEQRSHSLILTALDGGDPPRSATAHIEISVKDTNDNPPVFSRDEYRISLSENL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PCDHGB6 (NP_115271.1, 1 a.a. ~ 820 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 56100

Enviar uma mensagem


PCDHGB6 MaxPab mouse polyclonal antibody (B01)

PCDHGB6 MaxPab mouse polyclonal antibody (B01)