NXF2 monoclonal antibody (M08), clone 4G1
  • NXF2 monoclonal antibody (M08), clone 4G1

NXF2 monoclonal antibody (M08), clone 4G1

Ref: AB-H00056001-M08
NXF2 monoclonal antibody (M08), clone 4G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NXF2.
Información adicional
Size 100 ug
Gene Name NXF2
Gene Alias FLJ20416|TAPL-2
Gene Description nuclear RNA export factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DEIRITTWRNRKPPERKMSQNTQDGYTRNWFKVTIPYGIKYDKAWLMNSIQSHCSDRFTPVDFHYVRNRACFFV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NXF2 (AAH15020.1, 95 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56001
Clone Number 4G1
Iso type IgG2a Kappa

Enviar uma mensagem


NXF2 monoclonal antibody (M08), clone 4G1

NXF2 monoclonal antibody (M08), clone 4G1