NXF2 polyclonal antibody (A01)
  • NXF2 polyclonal antibody (A01)

NXF2 polyclonal antibody (A01)

Ref: AB-H00056001-A01
NXF2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant NXF2.
Información adicional
Size 50 uL
Gene Name NXF2
Gene Alias FLJ20416|TAPL-2
Gene Description nuclear RNA export factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MCSTLKKCGTYRTEVAECHDHGSTFQGRKKGGSSFRDNFDKRSCHYEHGGYERPPSHCQENDGSVEVRDVHKDQQLRHTPYSIRCERRMKWHSEDEIRITTWRNRKPPERKMGQNTQDGYTRNWFKVTIPYGIKYDKAWLMNSIQSHCSDRFTPVDFHYVRNRACFFVQDASAASALKDVSYKIYDDENQKICIFVNHSTAPYSVKNKLRPGQMEMLKLTMNKRYNVSQQALDLQNLRFDPDLMGRDIDIILNRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NXF2 (AAH15020, 1 a.a. ~ 626 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 56001

Enviar uma mensagem


NXF2 polyclonal antibody (A01)

NXF2 polyclonal antibody (A01)