NXF3 monoclonal antibody (M06), clone 3A9
  • NXF3 monoclonal antibody (M06), clone 3A9

NXF3 monoclonal antibody (M06), clone 3A9

Ref: AB-H00056000-M06
NXF3 monoclonal antibody (M06), clone 3A9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant NXF3.
Información adicional
Size 100 ug
Gene Name NXF3
Gene Alias -
Gene Description nuclear RNA export factor 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSLPSGHTTGHTDQVVQRRARCWDIYQRRFSSRSEPVNPGMHSSSHQQQDGDAAMHGAHMDSPVRYTPYTISPYNRKGSFRKQDQTHVNMEREQKPPERRMEGNMPDGTLGSWFKITVPFGIKYNEKWLLNLIQNECSVPFVPVEFHYENMHASFFVENASIAYALKNVSGKIWDEDNEKISIFVNPAGIPHFVHRELKSEKVEQIKLAMNQQCDVSQEALDIQRLPFYPDMVNRDTKMASNPRKCMAASLDVHE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NXF3 (AAH31616, 1 a.a. ~ 531 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 56000
Clone Number 3A9
Iso type IgG2a Kappa

Enviar uma mensagem


NXF3 monoclonal antibody (M06), clone 3A9

NXF3 monoclonal antibody (M06), clone 3A9