NXF5 polyclonal antibody (A01)
  • NXF5 polyclonal antibody (A01)

NXF5 polyclonal antibody (A01)

Ref: AB-H00055998-A01
NXF5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NXF5.
Información adicional
Size 50 uL
Gene Name NXF5
Gene Alias -
Gene Description nuclear RNA export factor 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FTGSETLKHLVLQFLQQSNLCKYFKDSRNIKILKDPYLQRKLLKHTKCPRNVDSLSALPETQHDFTSILVDMWYQTVNTCFLPRAGPESQRWWCLLSLKW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NXF5 (NP_116564, 271 a.a. ~ 370 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55998

Enviar uma mensagem


NXF5 polyclonal antibody (A01)

NXF5 polyclonal antibody (A01)