CFC1 MaxPab mouse polyclonal antibody (B01P)
  • CFC1 MaxPab mouse polyclonal antibody (B01P)

CFC1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055997-B01P
CFC1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CFC1 protein.
Información adicional
Size 50 ug
Gene Name CFC1
Gene Alias CRYPTIC|FLJ77897|HTX2|MGC133213
Gene Description cripto, FRL-1, cryptic family 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRAFGEGASARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRRSECGALEHGAWTLRACHLCRCIFGALHCLPLQTPDRCDPKDFLASHAHGPSAGGAPSLLLLLPCALLHRLLRPDAPAHPRSLVPSVLQRERRPCGRPGLGHRL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CFC1 (NP_115934.1, 1 a.a. ~ 223 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55997

Enviar uma mensagem


CFC1 MaxPab mouse polyclonal antibody (B01P)

CFC1 MaxPab mouse polyclonal antibody (B01P)