RAG1AP1 purified MaxPab mouse polyclonal antibody (B01P)
  • RAG1AP1 purified MaxPab mouse polyclonal antibody (B01P)

RAG1AP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00055974-B01P
RAG1AP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RAG1AP1 protein.
Información adicional
Size 50 ug
Gene Name RAG1AP1
Gene Alias SCP|slv
Gene Description recombination activating gene 1 activating protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDGILIVVNTVGAALQTLYILAYLHYCPRKAKVIQTKSTQCLSYPLTIATLLTSASWCLYGFRLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAG1AP1 (AAH09621, 1 a.a. ~ 167 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55974

Enviar uma mensagem


RAG1AP1 purified MaxPab mouse polyclonal antibody (B01P)

RAG1AP1 purified MaxPab mouse polyclonal antibody (B01P)