SEPT3 monoclonal antibody (M03), clone 4D8
  • SEPT3 monoclonal antibody (M03), clone 4D8

SEPT3 monoclonal antibody (M03), clone 4D8

Ref: AB-H00055964-M03
SEPT3 monoclonal antibody (M03), clone 4D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SEPT3.
Información adicional
Size 100 ug
Gene Name SEPT3
Gene Alias MGC133218|SEP3|bK250D10.3
Gene Description septin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEPT3 (NP_663786, 236 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55964
Clone Number 4D8
Iso type IgG1 Kappa

Enviar uma mensagem


SEPT3 monoclonal antibody (M03), clone 4D8

SEPT3 monoclonal antibody (M03), clone 4D8