SULF2 monoclonal antibody (M01), clone 2H5
  • SULF2 monoclonal antibody (M01), clone 2H5

SULF2 monoclonal antibody (M01), clone 2H5

Ref: AB-H00055959-M01
SULF2 monoclonal antibody (M01), clone 2H5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant SULF2.
Información adicional
Size 100 ug
Gene Name SULF2
Gene Alias DKFZp313E091|FLJ90554|HSULF-2|KIAA1247|MGC126411
Gene Description sulfatase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MPGLTCFTHDNQHWQTAPFWTLGPFCACTSANNNTYWCMRTINETHNFLFCEFATGFLEYFDLNTDPYQLMNAVNTLDRDVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKWPEMKRPSSKSLGQLWEGWEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SULF2 (AAH20962, 1 a.a. ~ 149 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55959
Clone Number 2H5
Iso type IgG2a Kappa

Enviar uma mensagem


SULF2 monoclonal antibody (M01), clone 2H5

SULF2 monoclonal antibody (M01), clone 2H5